Human GLI2 protein
This Human GLI2 protein spans the amino acid sequence from region 412-641aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
GLI family zinc finger protein 2 Tax helper protein
UniProt
P10070
Expression Region
412-641aa
Tag
N-terminal 6xHis-Myc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Stem Cell & Developmental Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
30.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial of HIS-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
EQLADLKEDLDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTREQKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQRNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HP218076 200 Reactions
LINC00311 Human qPCR Primer Pair (NM_153238)
Sign In for Pricing
View Details 
BNC743166-100 1x 100 µL
Granulocyte-Colony Stimulating Factor (G-CSF) (CSF3/3166R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GP-2101-10 1 mL
Colloidal Gold Conjugated Triticum vulgare Lectin (Wheat Germ) -WGA-, 1mL 10nm
Sign In for Pricing
View Details 