What is the catalog number for Human MAP2K6 protein?

The catalog number for Human MAP2K6 protein is orb358948.

What sizes are available for Human MAP2K6 protein?

Human MAP2K6 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human MAP2K6 protein come in?

Human MAP2K6 protein is available in 3 different pack sizes.

Is Human MAP2K6 protein in stock?

Human MAP2K6 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human MAP2K6 protein

This Human MAP2K6 protein spans the amino acid sequence from region 1-334aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAPK/ERK kinase 6 Short name, MEK 6 Stress-activated protein kinase kinase 3 Short name, SAPK kinase 3 Short name, SAPKK-3 Short name, SAPKK3

UniProt

P52564

Expression Region

1-334aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD