Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MAP2K6 protein

This Human MAP2K6 protein spans the amino acid sequence from region 1-334aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAPK/ERK kinase 6 Short name, MEK 6 Stress-activated protein kinase kinase 3 Short name, SAPK kinase 3 Short name, SAPKK-3 Short name, SAPKK3

UniProt

P52564

Expression Region

1-334aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of his-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Homing Associated Cell Adhesion Molecule (HCAM) Monoclonal Antibody
CAU35926-01 100 µL

Anti-Homing Associated Cell Adhesion Molecule (HCAM) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Homing Associated Cell Adhesion Molecule (HCAM) Monoclonal Antibody
CAU35926-02 200 µL

Anti-Homing Associated Cell Adhesion Molecule (HCAM) Monoclonal Antibody

Sign In for Pricing
View Details
Anti-Homing Associated Cell Adhesion Molecule (HCAM) Monoclonal Antibody
CAU35926-03 1 mL

Anti-Homing Associated Cell Adhesion Molecule (HCAM) Monoclonal Antibody

Sign In for Pricing
View Details
pExpress-1-Ube2g1 Plasmid
PVT55445 2 µg

pExpress-1-Ube2g1 Plasmid

Sign In for Pricing
View Details
Rucaparib (AG-014699) phosphate 5mg
A10045-5 5 mg

Rucaparib (AG-014699) phosphate 5mg

Sign In for Pricing
View Details
Slc7a10 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7560302 1.0 µg DNA

Slc7a10 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details