Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PAK7 protein

This Human PAK7 protein spans the amino acid sequence from region 1-293aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P21-activated kinase 5 Short name, PAK-5 p21-activated kinase 7 Short name, PAK-7

UniProt

Q8TB93

Expression Region

1-293aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of his-tag and expression region is 34.23kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified anti-mouse IgA
GT17834 50 µg

Purified anti-mouse IgA

Sign In for Pricing
View Details
Anti-PSMA7 Antibody Picoband® FITC Conjugated
A05091-1-FITC 100 µg/Vial

Anti-PSMA7 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
ATG13 Rabbit Polyclonal Antibody (Cy5.5)
orb1046406 100 µL

ATG13 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Lentiviral mouse Plekha5 shRNA (UAS) - Lentiviral mouse Plekha5 shRNA (UAS, RFP) plasmid
GTR15301288 1 Vial

Lentiviral mouse Plekha5 shRNA (UAS) - Lentiviral mouse Plekha5 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Anti-CCR3 Polyclonal Antibody
TMAB-00324-01 50 μL

Anti-CCR3 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-CCR3 Polyclonal Antibody
TMAB-00324-02 100 µL

Anti-CCR3 Polyclonal Antibody

Sign In for Pricing
View Details