What is the catalog number for Human PAK7 protein?

The catalog number for Human PAK7 protein is orb358947.

What sizes are available for Human PAK7 protein?

Human PAK7 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human PAK7 protein come in?

Human PAK7 protein is available in 3 different pack sizes.

Is Human PAK7 protein in stock?

Human PAK7 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human PAK7 protein

This Human PAK7 protein spans the amino acid sequence from region 1-293aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P21-activated kinase 5 Short name, PAK-5 p21-activated kinase 7 Short name, PAK-7

UniProt

Q8TB93

Expression Region

1-293aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of his-tag and expression region is 34.23kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFGKKKKKIEISGPSNFEHRVHTGFDAQEQKFTGLPQQWHSLLADTANRPKPMVDPSCITPIQLAPMKTIVRGNKPCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGASSHGPGHAEENGFITFSQYSSESDTTADYTTEKYREKSLYGDDLDPYYRGSHAAKQNGHVMKMKHGEAYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQ