What is the catalog number for Human CDK4 protein?

The catalog number for Human CDK4 protein is orb358946.

What sizes are available for Human CDK4 protein?

Human CDK4 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human CDK4 protein come in?

Human CDK4 protein is available in 3 different pack sizes.

Is Human CDK4 protein in stock?

Human CDK4 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human CDK4 protein

This Human CDK4 protein spans the amino acid sequence from region 2-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclin-dependent kinase 4 Cyclin-dependent kinase 4, isoform CRA_c

UniProt

P11802

Expression Region

2-303aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of his-tag and expression region is 35.33kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE