Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDK4 protein

This Human CDK4 protein spans the amino acid sequence from region 2-303aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cyclin-dependent kinase 4 Cyclin-dependent kinase 4, isoform CRA_c

UniProt

P11802

Expression Region

2-303aa

Tag

N-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of Extracellular of his-tag and expression region is 35.33kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRP2
SB033 1

TRP2

Sign In for Pricing
View Details
HTRA2 Rabbit pAb, IRDye 800CW conjugated
orb2863094 100 µL

HTRA2 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
HNRNPUL2 (NM_001079559) Human Over-expression Lysate
E45H04823-2 20 µg

HNRNPUL2 (NM_001079559) Human Over-expression Lysate

Sign In for Pricing
View Details
FGL2 Human qPCR Primer Pair (NM_006682)
HP209583 200 Reactions

FGL2 Human qPCR Primer Pair (NM_006682)

Sign In for Pricing
View Details
PE/Texas Red® Anti-human CD49 Antibody *ASC-1*
104921U2-AAT 500 Tests

PE/Texas Red® Anti-human CD49 Antibody *ASC-1*

Sign In for Pricing
View Details
L 652813
T32456 25 mg

L 652813

Sign In for Pricing
View Details