Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hapln1 protein

This Mouse Hapln1 protein spans the amino acid sequence from region 10-356aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cartilage-linking protein 1 Short name, Cartilage-link protein Proteoglycan link protein

UniProt

Q9QUP5

Expression Region

10-356aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ISVCWADHHLSDSYTPPDQDRVIHIQAENGPRLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLREVDVFVSMGYHKKTYGGYQGRVFLKGGSDNDASLVITDLTLEDYGRYKCEVIEGLEDDTAVVALELQGVVFPYFPRLGRYNLNFHEARQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKLLGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Inhibin, alpha Monoclonal Antibody
RD90634A-01 200 µL

Inhibin, alpha Monoclonal Antibody

Sign In for Pricing
View Details
Inhibin, alpha Monoclonal Antibody
RD90634A-02 3 mL

Inhibin, alpha Monoclonal Antibody

Sign In for Pricing
View Details
Inhibin, alpha Monoclonal Antibody
RD90634A-03 100 µL

Inhibin, alpha Monoclonal Antibody

Sign In for Pricing
View Details
Inhibin, alpha Monoclonal Antibody
RD90634A-04 6 mL

Inhibin, alpha Monoclonal Antibody

Sign In for Pricing
View Details
IGFBP4, ID (IGFBP4, IBP4, Insulin-like growth factor-binding protein 4) (MaxLight 405) discontinued
036914-ML405 100 µL

IGFBP4, ID (IGFBP4, IBP4, Insulin-like growth factor-binding protein 4) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PDPN antibody
70R-14211 0.1 mg

PDPN antibody

Sign In for Pricing
View Details