Human TSLP protein
This Human TSLP protein spans the amino acid sequence from region 29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Thymic stromal lymphopoietin, Thymic stromal lymphopoietin protein TSLP, Tslp, TSLP protein, TSLP_HUMAN
UniProt
Q969D9
Expression Region
29-159aa
Tag
N-terminal 6xHis-Myc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
18.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full length of HIS-tag and expression region is 18.51kDa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6358520-01 0.2 mL
TRIM59, NT (TRIM59, RNF104, TRIM57, TSBF1, Tripartite motif-containing protein 59, RING finger protein 104, Tumor suppressor TSBF-1) (FITC)
Sign In for Pricing
View Details MBS6358520-02 5x 0.2 mL
TRIM59, NT (TRIM59, RNF104, TRIM57, TSBF1, Tripartite motif-containing protein 59, RING finger protein 104, Tumor suppressor TSBF-1) (FITC)
Sign In for Pricing
View Details