Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TSLP protein

This Human TSLP protein spans the amino acid sequence from region 29-159aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thymic stromal lymphopoietin, Thymic stromal lymphopoietin protein TSLP, Tslp, TSLP protein, TSLP_HUMAN

UniProt

Q969D9

Expression Region

29-159aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 18.51kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKLF (Kruppel-like Factor 11, Kruppel-type Zinc Finger Protein) (HRP)
MBS6452360-01 0.1 mL

FKLF (Kruppel-like Factor 11, Kruppel-type Zinc Finger Protein) (HRP)

Sign In for Pricing
View Details
FKLF (Kruppel-like Factor 11, Kruppel-type Zinc Finger Protein) (HRP)
MBS6452360-02 5x 0.1 mL

FKLF (Kruppel-like Factor 11, Kruppel-type Zinc Finger Protein) (HRP)

Sign In for Pricing
View Details
ZNF444 (Zinc Finger Protein 444, Endothelial Zinc Finger Protein 2, EZF2, EZF-2, Zinc Finger and SCAN Domain-containing Protein 17, ZSCAN17) (MaxLight 490)
MBS6204222-01 0.1 mL

ZNF444 (Zinc Finger Protein 444, Endothelial Zinc Finger Protein 2, EZF2, EZF-2, Zinc Finger and SCAN Domain-containing Protein 17, ZSCAN17) (MaxLight 490)

Sign In for Pricing
View Details
ZNF444 (Zinc Finger Protein 444, Endothelial Zinc Finger Protein 2, EZF2, EZF-2, Zinc Finger and SCAN Domain-containing Protein 17, ZSCAN17) (MaxLight 490)
MBS6204222-02 5x 0.1 mL

ZNF444 (Zinc Finger Protein 444, Endothelial Zinc Finger Protein 2, EZF2, EZF-2, Zinc Finger and SCAN Domain-containing Protein 17, ZSCAN17) (MaxLight 490)

Sign In for Pricing
View Details
RBM7 Rabbit Polyclonal Antibody
orb577792 100 µL

RBM7 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SETBP1 siRNA (Human)
CRH8673-01 15 nmol

SETBP1 siRNA (Human)

Sign In for Pricing
View Details