Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Lum protein

This Rat Lum protein spans the amino acid sequence from region 19-338aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Keratan sulfate proteoglycan lumican Short name, KSPG lumican

UniProt

P51886

Expression Region

19-338aa

Tag

N-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QYYDYDAPLFMYGELSPNCAPECNCPHSYPTAMYCDDLKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGKVFSKLKQLKKLHINYNNLTESVGPLPKSLQDLQLANNKISKLGSFDGLVNLTFIYLQHNQLKEEAVSASLKGLKSLEYLDLSFNQMSKLPAGLPTSLLTLYLDNNKITNIPDEYFNRFTGLQYLRLSHNELADSGVPGNSFNISSLLELDLSYNKLKSIPTVNENLENYYLEVNKLEKFDVKSFCKILGPLSYSKIKHLRLDGNPLTQSSLPPDMYECLRVANEITVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beclin 1 (BECN1) Antibody (HRP)
abx446543 100 µg

Beclin 1 (BECN1) Antibody (HRP)

Sign In for Pricing
View Details
CA5B Rabbit Polyclonal Antibody
54446-01 50 µL

CA5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CA5B Rabbit Polyclonal Antibody
54446-02 100 µL

CA5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Anti MCT1 mouse monoclonal antibody
MBS157958-01 0.1 mL

Anti MCT1 mouse monoclonal antibody

Sign In for Pricing
View Details
Anti MCT1 mouse monoclonal antibody
MBS157958-02 5x 0.1 mL

Anti MCT1 mouse monoclonal antibody

Sign In for Pricing
View Details
Klf4 3'UTR Lenti-reporter-Luc Vector
25753084 1.0 µg

Klf4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details