Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Trem2 protein

This Mouse Trem2 protein spans the amino acid sequence from region 19-171aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Triggering receptor expressed on monocytes 2

UniProt

Q99NH8

Expression Region

19-171aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 20.93kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP26A1, CT (CYP26A1, CYP26, P450RAI1, Cytochrome P450 26A1, Cytochrome P450 retinoic acid-inactivating 1, Retinoic acid 4-hydroxylase, Retinoic acid-metabolizing cytochrome) (MaxLight 550)
MBS6290459-01 0.1 mL

CYP26A1, CT (CYP26A1, CYP26, P450RAI1, Cytochrome P450 26A1, Cytochrome P450 retinoic acid-inactivating 1, Retinoic acid 4-hydroxylase, Retinoic acid-metabolizing cytochrome) (MaxLight 550)

Sign In for Pricing
View Details
CYP26A1, CT (CYP26A1, CYP26, P450RAI1, Cytochrome P450 26A1, Cytochrome P450 retinoic acid-inactivating 1, Retinoic acid 4-hydroxylase, Retinoic acid-metabolizing cytochrome) (MaxLight 550)
MBS6290459-02 5x 0.1 mL

CYP26A1, CT (CYP26A1, CYP26, P450RAI1, Cytochrome P450 26A1, Cytochrome P450 retinoic acid-inactivating 1, Retinoic acid 4-hydroxylase, Retinoic acid-metabolizing cytochrome) (MaxLight 550)

Sign In for Pricing
View Details
Pilosulyne D
orb2893411-01 50 mg

Pilosulyne D

Sign In for Pricing
View Details
Pilosulyne D
orb2893411-02 10 mg

Pilosulyne D

Sign In for Pricing
View Details
Zaleplon Related Compound C (Secondary Standards traceble to USP)
CS-ER-02258 1 Each

Zaleplon Related Compound C (Secondary Standards traceble to USP)

Sign In for Pricing
View Details
VAPA (Vesicle-associated Membrane Protein-associated Protein A, VAMP-associated Protein A, VAMP-A, VAP-A, 33kD VAMP-associated Protein, VAP33, VAP-33, hVAP-33) (APC)
135204-APC 100 µL

VAPA (Vesicle-associated Membrane Protein-associated Protein A, VAMP-associated Protein A, VAMP-A, VAP-A, 33kD VAMP-associated Protein, VAP33, VAP-33, hVAP-33) (APC)

Sign In for Pricing
View Details