What is the catalog number for Human CLEC4C protein?

The catalog number for Human CLEC4C protein is orb358925.

What sizes are available for Human CLEC4C protein?

Human CLEC4C protein is available in the following size(s): 500 µg.

Is Human CLEC4C protein in stock?

Human CLEC4C protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human CLEC4C protein

This Human CLEC4C protein spans the amino acid sequence from region 45-213aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Blood dendritic cell antigen 2 Short name, BDCA-2 C-type lectin superfamily member 7 Dendritic lectin CD_antigen, CD303

UniProt

Q8WTT0

Expression Region

45-213aa

Tag

N-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test.

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 6 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 26.79kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVMGADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIINFRSSEEWGWNDIHCHVPQKSICKMKKIYI