Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Envelope glycoprotein protein

This Viral Envelope glycoprotein protein spans the amino acid sequence from region 502-637aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP1,2 Short name, GP

UniProt

Q7T9D9

Expression Region

502-637aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Sudan ebolavirus (strain Human/Uganda/Gulu/2000) (SEBOV) (Sudan Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of HIS-tag and expression region is 23.16kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Antithrombin III (SERPINC1) ELISA Kit
MBS9377145-01 48 Well

Mouse Antithrombin III (SERPINC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Antithrombin III (SERPINC1) ELISA Kit
MBS9377145-02 96 Well

Mouse Antithrombin III (SERPINC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Antithrombin III (SERPINC1) ELISA Kit
MBS9377145-03 5x 96 Well

Mouse Antithrombin III (SERPINC1) ELISA Kit

Sign In for Pricing
View Details
Mouse Antithrombin III (SERPINC1) ELISA Kit
MBS9377145-04 10x 96 Well

Mouse Antithrombin III (SERPINC1) ELISA Kit

Sign In for Pricing
View Details
TGF beta 2 Antibody
GWB-BE4030 0.5 mL

TGF beta 2 Antibody

Sign In for Pricing
View Details
CDK11 Rabbit Polyclonal Antibody (Cy5)
orb897087 100 µL

CDK11 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details