Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Viral Envelope glycoprotein protein

This Viral Envelope glycoprotein protein spans the amino acid sequence from region 502-637aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GP1,2 Short name, GP

UniProt

Q7T9D9

Expression Region

502-637aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Sudan ebolavirus (strain Human/Uganda/Gulu/2000) (SEBOV) (Sudan Ebola virus)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial of HIS-tag and expression region is 23.16kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human UNC13D Protein, N-His
MBS1578020-01 0.1 mg

Recombinant Human UNC13D Protein, N-His

Sign In for Pricing
View Details
Recombinant Human UNC13D Protein, N-His
MBS1578020-02 1 mg

Recombinant Human UNC13D Protein, N-His

Sign In for Pricing
View Details
Recombinant Human UNC13D Protein, N-His
MBS1578020-03 5x 1 mg

Recombinant Human UNC13D Protein, N-His

Sign In for Pricing
View Details
Lrg1 (NM_029796) Mouse Tagged Lenti ORF Clone
MR205144L2 10 µg

Lrg1 (NM_029796) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TCAF2 Antibody, Biotin conjugated
A21239-50UG 50 µg

TCAF2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Angiopoietin 2 (ANGPT2) BioAssayTM ECL ELISA Kit (Human)
157388 96 Tests

Angiopoietin 2 (ANGPT2) BioAssayTM ECL ELISA Kit (Human)

Sign In for Pricing
View Details