Human C5a protein
This Human C5a protein spans the amino acid sequence from region 678-751aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Anaphylatoxin C5a analog protein, Anaphylatoxin C5a protein, C5a anaphylatoxin protein, C5a des Arg protein, Complement C5 alpha chain protein, Complement C5 protein, Complement component C5 protein, Complement component C5a protein, CPAMD4 protein
UniProt
P01031
Expression Region
678-751aa
Tag
N-terminal 6xHis-Myc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Signal Transduction
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
12.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial of HIS-tag and expression region is 16.34kDa
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15233267 1 Vial
Lentiviral mouse Has1 shRNA (UAS) - Lentiviral mouse Has1 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 
MBS628633-01 0.2 mL
CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1)
Sign In for Pricing
View Details MBS628633-02 5x 0.2 mL
CRIPTO, CT (Teratocarcinoma-derived Growth Factor 1, Epidermal Growth Factor-like Cripto Protein CR1, Cripto-1 Growth Factor, CRGF, TDGF1)
Sign In for Pricing
View Details GTR15255188 1 Vial
Lentiviral mouse Lrrc38 shRNA (UAS) - Lentiviral mouseLrrc38 shRNA (UAS, GFP) (25)
Sign In for Pricing
View Details GTR15387690 1 Vial
Lentiviral human ADCYAP1R1 sgRNA gene knockout kit - Lentiviral human ADCYAP1R1 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details