Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey Transthyretin protein

This Monkey Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amyloidosis I protein, ATTR protein, CTS protein, CTS1 protein, HEL111 protein, HsT2651 protein, PALB protein, Prealbumin amyloidosis type I protein, TBPA protein, Transthyretin protein, TTR protein, TTR protein protein

UniProt

Q8HXW1

Expression Region

21-147aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 18.07kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rno-miR-881-3p miRNA Antagomir
orb1911524-01 10 nmol

Rno-miR-881-3p miRNA Antagomir

Sign In for Pricing
View Details
Rno-miR-881-3p miRNA Antagomir
orb1911524-02 20 nmol

Rno-miR-881-3p miRNA Antagomir

Sign In for Pricing
View Details
DPPA4 Human shRNA Plasmid Kit (Locus ID 55211)
TR304914 1 Kit

DPPA4 Human shRNA Plasmid Kit (Locus ID 55211)

Sign In for Pricing
View Details
GBA Adenovirus (Human)
21342051 1.0 mL

GBA Adenovirus (Human)

Sign In for Pricing
View Details
pCMV-SPORT6-PEX6 Plasmid
PVT16881 2 µg

pCMV-SPORT6-PEX6 Plasmid

Sign In for Pricing
View Details
PGA3 Antibody, Biotin conjugated
A44467-100UG 100 µg

PGA3 Antibody, Biotin conjugated

Sign In for Pricing
View Details