Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey Transthyretin protein

This Monkey Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amyloidosis I protein, ATTR protein, CTS protein, CTS1 protein, HEL111 protein, HsT2651 protein, PALB protein, Prealbumin amyloidosis type I protein, TBPA protein, Transthyretin protein, TTR protein, TTR protein protein

UniProt

Q8HXW1

Expression Region

21-147aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 18.07kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Niobium nitride
RM8712-10G 1 unit

Niobium nitride

Sign In for Pricing
View Details
Chicken Aldo keto reductase family 1 member B10 (AKR1B10) ELISA kit
GTR10431930 96 Well

Chicken Aldo keto reductase family 1 member B10 (AKR1B10) ELISA kit

Sign In for Pricing
View Details
ENSA Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV658577 1.0 µg DNA

ENSA Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
PIM1 (PIM-1, Oncogene PIM1, Oncogene PIM-1, Pim1 Kinase, Pim-1 Kinase, Pim1 Oncogene, Pim-1 Oncogene, PIM, Proto-oncogene Serine/threonine-protein Kinase Pim-1, Proto-oncogene Serine/threonine Protein Kinase Pim1) (MaxLight 550)
131351-ML550 100 µL

PIM1 (PIM-1, Oncogene PIM1, Oncogene PIM-1, Pim1 Kinase, Pim-1 Kinase, Pim1 Oncogene, Pim-1 Oncogene, PIM, Proto-oncogene Serine/threonine-protein Kinase Pim-1, Proto-oncogene Serine/threonine Protein Kinase Pim1) (MaxLight 550)

Sign In for Pricing
View Details
TIP60 (phospho Ser90) Polyclonal Antibody
ABP53497-01 30 µL

TIP60 (phospho Ser90) Polyclonal Antibody

Sign In for Pricing
View Details
TIP60 (phospho Ser90) Polyclonal Antibody
ABP53497-02 100 µL

TIP60 (phospho Ser90) Polyclonal Antibody

Sign In for Pricing
View Details