Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey Transthyretin protein

This Monkey Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amyloidosis I protein, ATTR protein, CTS protein, CTS1 protein, HEL111 protein, HsT2651 protein, PALB protein, Prealbumin amyloidosis type I protein, TBPA protein, Transthyretin protein, TTR protein, TTR protein protein

UniProt

Q8HXW1

Expression Region

21-147aa

Tag

N-terminal 6xHis-Myc-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of HIS-tag and expression region is 18.07kDa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPTGVDESKCPLMVKVLDAVRGSPAVNVAVNVFKKAADETWAPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKSLGISPFHEHAEVVFTANDSGPRHYTIAALLSPYSYSTTAVVTNPKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase-7 (N-terminal region) Antibody
MBS474259-01 0.1 mL

Caspase-7 (N-terminal region) Antibody

Sign In for Pricing
View Details
Caspase-7 (N-terminal region) Antibody
MBS474259-02 5x 0.1 mL

Caspase-7 (N-terminal region) Antibody

Sign In for Pricing
View Details
CL2-SN-38 1mg
A18945-1 1 mg

CL2-SN-38 1mg

Sign In for Pricing
View Details
KIF2B Lentiviral Activation Particles (h2)
sc-413680-LAC-2 200 µL

KIF2B Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
DDX11 (AK021703) Human Untagged Clone
SC312270 10 µg

DDX11 (AK021703) Human Untagged Clone

Sign In for Pricing
View Details
Argininosuccinate synthase 1 Recombinant Antibody, PerCP Conjugated
bsm-62194R-PerCP-TR 20 µL

Argininosuccinate synthase 1 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details