What is the catalog number for Insect pmp20 protein?

The catalog number for Insect pmp20 protein is orb358889.

What sizes are available for Insect pmp20 protein?

Insect pmp20 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Insect pmp20 protein come in?

Insect pmp20 protein is available in 3 different pack sizes.

Is Insect pmp20 protein in stock?

Insect pmp20 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Insect pmp20 protein

This Insect pmp20 protein spans the amino acid sequence from region 1-168aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein pmp20 Thioredoxin reductase Allergen, Asp f 3

UniProt

O43099

Expression Region

1-168aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) (Aspergillus fumigatus)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGLKAGDSFPSDVVFSYIPWSEDKGEITACGIPINYNASKEWADKKVILFALPGAFTPVCSARHVPEYIEKLPEIRAKGVDVVAVLAYNDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIGWADEEGRTKRYALVIDHGKITYAALEPAKNHLEFSSAETVLKHL