Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant CDC48 protein

This Plant CDC48 protein spans the amino acid sequence from region 653-807aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Valosin-containing protein homolog Short name, VCP

UniProt

P54774

Expression Region

653-807aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-amino-1mq (Peptide)
50AM 50mg x 10 Vials (5mL)

5-amino-1mq (Peptide)

Sign In for Pricing
View Details
HNRNPR Protein (N-His, Human)
P504675 100 µg

HNRNPR Protein (N-His, Human)

Sign In for Pricing
View Details
UMOD Protein Vector (Mouse) (pPB-N-His)
PV244127 500 ng

UMOD Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
LARP1 Protein Vector (Human) (pPM-C-His)
PV023360 500 ng

LARP1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
High density lipoprotein Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2416359 100 µL

High density lipoprotein Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Mouse Period circadian protein homolog 3 (PER3) ELISA Kit
AE27999MO-01 48 Tests

Mouse Period circadian protein homolog 3 (PER3) ELISA Kit

Sign In for Pricing
View Details