Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant CDC48 protein

This Plant CDC48 protein spans the amino acid sequence from region 653-807aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Valosin-containing protein homolog Short name, VCP

UniProt

P54774

Expression Region

653-807aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxy-1-tetralone 99+% (HPLC)
234220-01 1 g

5-Hydroxy-1-tetralone 99+% (HPLC)

Sign In for Pricing
View Details
5-Hydroxy-1-tetralone 99+% (HPLC)
234220-02 5 g

5-Hydroxy-1-tetralone 99+% (HPLC)

Sign In for Pricing
View Details
5-Hydroxy-1-tetralone 99+% (HPLC)
234220-03 25 g

5-Hydroxy-1-tetralone 99+% (HPLC)

Sign In for Pricing
View Details
5-Hydroxy-1-tetralone 99+% (HPLC)
234220-04 100 g

5-Hydroxy-1-tetralone 99+% (HPLC)

Sign In for Pricing
View Details
TTC Wiper-7 Agar 10 x 60 mm Petri
TMB_TTCT7_P60_10 10 x 60 mm Petri

TTC Wiper-7 Agar 10 x 60 mm Petri

Sign In for Pricing
View Details
Human Inhibitor of growth protein 3, ING3 ELISA Kit
MBS9332686-01 48 Well

Human Inhibitor of growth protein 3, ING3 ELISA Kit

Sign In for Pricing
View Details