Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Snaclec rhodocytin subunit beta protein

This Reptile Snaclec rhodocytin subunit beta protein spans the amino acid sequence from region 24-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aggretin beta chain Rhodoaggretin subunit beta

UniProt

Q9I840

Expression Region

24-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBPH siRNA (m)
sc-149311 10 µM

MBPH siRNA (m)

Sign In for Pricing
View Details
PIG3 (A-5) AC
sc-166664 AC 500 µg/mL - 25% ag

PIG3 (A-5) AC

Sign In for Pricing
View Details
Bradykinin [Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH; MW: 1060.22]
SP-52227-5 5 mg

Bradykinin [Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg-OH; MW: 1060.22]

Sign In for Pricing
View Details
Human Cystin 1 (CYS1) ELISA Kit
QY-E05002 96 Tests

Human Cystin 1 (CYS1) ELISA Kit

Sign In for Pricing
View Details
Human KMT2C Knockout A549 cell line
GTR15409930 1 Vial

Human KMT2C Knockout A549 cell line

Sign In for Pricing
View Details
Anti-CD63 Antibody
CPA9769-01 30 µL

Anti-CD63 Antibody

Sign In for Pricing
View Details