Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Snaclec rhodocytin subunit beta protein

This Reptile Snaclec rhodocytin subunit beta protein spans the amino acid sequence from region 24-146aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aggretin beta chain Rhodoaggretin subunit beta

UniProt

Q9I840

Expression Region

24-146aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Heat Shock Protein 105kDa (HSPH1) ELISA Kit
MBS9345259 Inquire

Cavy Heat Shock Protein 105kDa (HSPH1) ELISA Kit

Sign In for Pricing
View Details
Ribonuclease A8 (RNASE8) Polyclonal Antibody
CAU23501-01 100 µL

Ribonuclease A8 (RNASE8) Polyclonal Antibody

Sign In for Pricing
View Details
Ribonuclease A8 (RNASE8) Polyclonal Antibody
CAU23501-02 200 µL

Ribonuclease A8 (RNASE8) Polyclonal Antibody

Sign In for Pricing
View Details
Ribonuclease A8 (RNASE8) Polyclonal Antibody
CAU23501-03 1 mL

Ribonuclease A8 (RNASE8) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti Human ACER1 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 120ul
IRBAHUACER1AAP827120UL 120 µL

Rabbit Anti Human ACER1 Polyclonal Antigen affinity Purified (PBS with 0.05% NaN3 and 40% Glycerol, pH7.4) (IHC,ELISA) 120ul

Sign In for Pricing
View Details
TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF640R conjugate, 0.1mg/mL
BNC402059-100 1x 100 µL

TNFS15 / VEGI (Vascular Endothelial Growth Inhibitor) (rVEGI/1283), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details