Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Reptile Snaclec rhodocytin subunit alpha protein

This Reptile Snaclec rhodocytin subunit alpha protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Aggretin alpha chain Rhodoaggretin subunit alpha

UniProt

Q9I841

Expression Region

1-136aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biosafety Transport Box BTBT-107
BTBT-107 1 Unit

Biosafety Transport Box BTBT-107

Sign In for Pricing
View Details
Recombinant AMBP Antibody
RC-15636-01 50 μL

Recombinant AMBP Antibody

Sign In for Pricing
View Details
Recombinant AMBP Antibody
RC-15636-02 100 µL

Recombinant AMBP Antibody

Sign In for Pricing
View Details
Recombinant AMBP Antibody
RC-15636-03 1 mL

Recombinant AMBP Antibody

Sign In for Pricing
View Details
Human ARL6IP4 activation kit by CRISPRa
GA109745 1 Kit

Human ARL6IP4 activation kit by CRISPRa

Sign In for Pricing
View Details
Ethyl 3-(4-Chlorophenyl)-3-oxopropanoate
TRC-B124820-50MG 50 mg

Ethyl 3-(4-Chlorophenyl)-3-oxopropanoate

Sign In for Pricing
View Details