Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey EGM_08965 protein

This Monkey EGM_08965 protein spans the amino acid sequence from region 1-304aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

G7PWA0

Expression Region

1-304aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNHAGKRELNTEKASTNGETNRGESEKKTNLGELSRTTSEDSEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGVPKRGSGKDSHHAARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGVDAQGTLSRIFKLGGRDSRSGSPMARR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (Endothelial Cell Marker), 0.2mg/mL
BNUB1662-500 1x 500 µL

CD31 / PECAM-1 (Endothelial Cell Marker), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant Human Glycine receptor subunit alpha-4 (GLRA4)
MBS7015884-01 0.02 mg

Recombinant Human Glycine receptor subunit alpha-4 (GLRA4)

Sign In for Pricing
View Details
Recombinant Human Glycine receptor subunit alpha-4 (GLRA4)
MBS7015884-02 0.1 mg

Recombinant Human Glycine receptor subunit alpha-4 (GLRA4)

Sign In for Pricing
View Details
Recombinant Human Glycine receptor subunit alpha-4 (GLRA4)
MBS7015884-03 5x 0.1 mg

Recombinant Human Glycine receptor subunit alpha-4 (GLRA4)

Sign In for Pricing
View Details
Rabbit Anti-Human CDCP1 Polyclonal Antibody
PA83465HU-01 50 µg

Rabbit Anti-Human CDCP1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CDCP1 Polyclonal Antibody
PA83465HU-02 100 µg

Rabbit Anti-Human CDCP1 Polyclonal Antibody

Sign In for Pricing
View Details