Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey EGM_08965 protein

This Monkey EGM_08965 protein spans the amino acid sequence from region 1-304aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

G7PWA0

Expression Region

1-304aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGNHAGKRELNTEKASTNGETNRGESEKKTNLGELSRTTSEDSEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGVPKRGSGKDSHHAARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGVDAQGTLSRIFKLGGRDSRSGSPMARR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Mastermind-like protein 1 (C-His)
BP2630-50ug 50 µg

Recombinant Human Mastermind-like protein 1 (C-His)

Sign In for Pricing
View Details
Lentiviral mouse Ly96 shRNA (UAS) - Lentiviral mouse Ly96 shRNA (UAS) plasmid
GTR15266731 1 Vial

Lentiviral mouse Ly96 shRNA (UAS) - Lentiviral mouse Ly96 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal NLRC3 Antibody [DyLight 550]
NBP2-41123R 0.1 mL

Rabbit Polyclonal NLRC3 Antibody [DyLight 550]

Sign In for Pricing
View Details
MARK3 Human qPCR Primer Pair (NM_002376)
HP206073 200 Reactions

MARK3 Human qPCR Primer Pair (NM_002376)

Sign In for Pricing
View Details
Anti-human TPBG (PF-06263507 Biosimilar)
BIO0354SM-5mg 5 mg

Anti-human TPBG (PF-06263507 Biosimilar)

Sign In for Pricing
View Details
THSD1 Antibody
orb255577 100 µL

THSD1 Antibody

Sign In for Pricing
View Details