Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SDC4 protein

This Human SDC4 protein spans the amino acid sequence from region 19-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amphiglycan Ryudocan core protein

UniProt

P31431

Expression Region

19-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD276 Recombinant Rabbit Monoclonal Antibody [PSH05-92] - BSA and Azide free (Capture)
HA722491 100 µL

Human CD276 Recombinant Rabbit Monoclonal Antibody [PSH05-92] - BSA and Azide free (Capture)

Sign In for Pricing
View Details
ESAM Antibody
OACD03287-1ML 1 mL

ESAM Antibody

Sign In for Pricing
View Details
Promyelocytic Leukemia Protein (PML) Human ELISA Kit
G1914 96 Tests

Promyelocytic Leukemia Protein (PML) Human ELISA Kit

Sign In for Pricing
View Details
Biotinylated Anti-IGF-1R (lonigutamab biosimilar) mAb
12-90200B-50 50 µg

Biotinylated Anti-IGF-1R (lonigutamab biosimilar) mAb

Sign In for Pricing
View Details
Tcp11l2-set siRNA/shRNA/RNAi Lentivector (Rat)
46418096 4x 500 ng

Tcp11l2-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
LBA Antibody
MBS9019170-01 0.05 mL

LBA Antibody

Sign In for Pricing
View Details