Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SDC4 protein

This Human SDC4 protein spans the amino acid sequence from region 19-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amphiglycan Ryudocan core protein

UniProt

P31431

Expression Region

19-145aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Immunoglobulin G2A (IGG2A) Polyclonal antibody
FY-AB33586-01 1 mL

Anti-Immunoglobulin G2A (IGG2A) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Immunoglobulin G2A (IGG2A) Polyclonal antibody
FY-AB33586-02 100 µL

Anti-Immunoglobulin G2A (IGG2A) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Immunoglobulin G2A (IGG2A) Polyclonal antibody
FY-AB33586-03 200 µL

Anti-Immunoglobulin G2A (IGG2A) Polyclonal antibody

Sign In for Pricing
View Details
Fibrinogen gamma chain Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61097R-BF350-01 20 µL

Fibrinogen gamma chain Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Fibrinogen gamma chain Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61097R-BF350-02 100 µL

Fibrinogen gamma chain Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
Beta-Parvin (PARVB) Antibody
abx457146-01 50 µg

Beta-Parvin (PARVB) Antibody

Sign In for Pricing
View Details