Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Sarcoplasmic calcium binding protein protein

This Animal Sarcoplasmic calcium binding protein protein spans the amino acid sequence from region 1-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

E7CGC4

Expression Region

1-193aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Penaeus monodon (Giant tiger prawn)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAYSWDNRVKYVVRYMYDIDNNGFLDKNDFECLAVRNTLIEGRGEFSADAYANNQKIMRNLWNEIAELADFNKDGEVTVDEFKQAVQKHCQGKKYGDFPGAFKVFIANQFKAIDVNGDGKVGLDEYRLDCITRSAFAEVKEIDDAYNKLTTEDDRKAGGLTLERYQDLYAQFISNPDESCSACYLFGPLKVVQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIC1 (Hypermethylated in Cancer 1 Protein, Hic-1, Zinc Finger and BTB Domain-containing Protein 29, ZBTB29) (FITC)
127850-FITC 100 µL

HIC1 (Hypermethylated in Cancer 1 Protein, Hic-1, Zinc Finger and BTB Domain-containing Protein 29, ZBTB29) (FITC)

Sign In for Pricing
View Details
CDON Protein Vector (Human) (pPM-C-HA)
15744021 500 ng

CDON Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit
MBS459686-01 48 Tests

Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit

Sign In for Pricing
View Details
Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit
MBS459686-02 96 Tests

Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit

Sign In for Pricing
View Details
Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit
MBS459686-03 5x 96 Tests

Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit

Sign In for Pricing
View Details
Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit
MBS459686-04 10x 96 Tests

Bovine Glutathione Peroxidase 1 (GPX1) ELISA Kit

Sign In for Pricing
View Details