Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish cyp c 1.02 protein

This Fish cyp c 1.02 protein spans the amino acid sequence from region 1-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8UUS2

Expression Region

1-109aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Cyprinus carpio (Common carp)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-HEAB
YF-PA25704 50 ul

anti-HEAB

Sign In for Pricing
View Details
SRGAP3 Antibody, FITC conjugated
A35606-50UG 50 µg

SRGAP3 Antibody, FITC conjugated

Sign In for Pricing
View Details
ASF1B Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA813129S 30 µL

ASF1B Mouse Monoclonal Antibody [Clone ID: OTI1E9]

Sign In for Pricing
View Details
KIF2A Antibody
orb52719-01 50 µg

KIF2A Antibody

Sign In for Pricing
View Details
KIF2A Antibody
orb52719-02 100 µg

KIF2A Antibody

Sign In for Pricing
View Details
Endomucin (EMCN) Human Over-expression Lysate
orb1369154 20 µg

Endomucin (EMCN) Human Over-expression Lysate

Sign In for Pricing
View Details