Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fish cyp c 1.02 protein

This Fish cyp c 1.02 protein spans the amino acid sequence from region 1-109aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

Q8UUS2

Expression Region

1-109aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Cyprinus carpio (Common carp)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFAGVLNDADITAALEACKAADSFNHKTFFAKVGLTSKSADDVKKAFAIIDQDKSGFIEEDELKLFLQNFKAGARALTDGETKTFLKAGDSDGDGKIGVDEFTALVKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD54 (NM_138797) Human Tagged ORF Clone Lentiviral Particle
RC203528L3V 200 µL

ANKRD54 (NM_138797) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
beta Gal (FL2) Antibody
MBS440076-01 0.2 mg

beta Gal (FL2) Antibody

Sign In for Pricing
View Details
beta Gal (FL2) Antibody
MBS440076-02 5x 0.2 mg

beta Gal (FL2) Antibody

Sign In for Pricing
View Details
Grainyhead like protein 1 homolog (GRHL1) CytoSection
TS429312P5 25 Slides

Grainyhead like protein 1 homolog (GRHL1) CytoSection

Sign In for Pricing
View Details
GRCR1 rabbit pAb
E44H15795 100 µL

GRCR1 rabbit pAb

Sign In for Pricing
View Details
MRPS27 Protein Vector (Human) (pPM-C-HA)
PV026767 500 ng

MRPS27 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details