Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human UNC119 protein

This Human UNC119 protein spans the amino acid sequence from region 1-240aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Retinal protein 4 Short name, hRG4

UniProt

Q13432

Expression Region

1-240aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKVKKGGGGAGTATESAPGPSGQSVAPIPQPPAESESGSESEPDAGPGPRPGPLQRKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFEIKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIERHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFVDDRLVMHNKADYSYSGTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hdgfl3 shRNA (UAS) - Lentiviral mouseHdgfl3 shRNA (UAS, GFP) (25)
GTR15148976 1 Vial

Lentiviral mouse Hdgfl3 shRNA (UAS) - Lentiviral mouseHdgfl3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CCR10 Rabbit Polyclonal Antibody (PE-Cy7)
orb909518 100 µL

CCR10 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Hsa-miR-4486 miRNA Agomir
orb1920247-01 5 nmol

Hsa-miR-4486 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4486 miRNA Agomir
orb1920247-02 10 nmol

Hsa-miR-4486 miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-4486 miRNA Agomir
orb1920247-03 20 nmol

Hsa-miR-4486 miRNA Agomir

Sign In for Pricing
View Details
EEF2/Elongation factor 2 Rabbit mAb
F3612-100uL 100 µL

EEF2/Elongation factor 2 Rabbit mAb

Sign In for Pricing
View Details