Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SRR protein

This Human SRR protein spans the amino acid sequence from region 1-340aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

D-serine ammonia-lyase D-serine dehydratase L-serine ammonia-lyase L-serine dehydratase

UniProt

Q9GZT4

Expression Region

1-340aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCAQYCISFADVEKAHINIRDSIHLTPVLTSSILNQLTGRNLFFKCELFQKTGSFKIRGALNAVRSLVPDALERKPKAVVTHSSGNHGQALTYAAKLEGIPAYIVVPQTAPDCKKLAIQAYGASIVYCEPSDESRENVAKRVTEETEGIMVHPNQEPAVIAGQGTIALEVLNQVPLVDALVVPVGGGGMLAGIAITVKALKPSVKVYAAEPSNADDCYQSKLKGKLMPNLYPPETIADGVKSSIGLNTWPIIRDLVDDIFTVTEDEIKCATQLVWERMKLLIEPTAGVGVAAVLSQHFQTVSPEVKNICIVLSGGNVDLTSSITWVKQAERPASYQSVSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NOS3 Pre-designed siRNA Set A
SI010691A 1 Each

Human NOS3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
IL2RG (Interleukin-2 Receptor Subunit gamma, P64, CIDX, IMD4, CD132, SCIDX, IL-2RG, SCIDX1) (Biotin)
MBS6422549-01 0.1 mL

IL2RG (Interleukin-2 Receptor Subunit gamma, P64, CIDX, IMD4, CD132, SCIDX, IL-2RG, SCIDX1) (Biotin)

Sign In for Pricing
View Details
IL2RG (Interleukin-2 Receptor Subunit gamma, P64, CIDX, IMD4, CD132, SCIDX, IL-2RG, SCIDX1) (Biotin)
MBS6422549-02 5x 0.1 mL

IL2RG (Interleukin-2 Receptor Subunit gamma, P64, CIDX, IMD4, CD132, SCIDX, IL-2RG, SCIDX1) (Biotin)

Sign In for Pricing
View Details
Mouse Glutathione peroxidase 4 (GPX4) ELISA Kit
YP-W28280-01 48 Tests

Mouse Glutathione peroxidase 4 (GPX4) ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione peroxidase 4 (GPX4) ELISA Kit
YP-W28280-02 96 Tests

Mouse Glutathione peroxidase 4 (GPX4) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human CCT6A shRNA (UAS) - Lentiviral human CCT6A shRNA (UAS, RFP) (25)
GTR15338918 1 Vial

Lentiviral human CCT6A shRNA (UAS) - Lentiviral human CCT6A shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details