Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial spi protein

This Bacterial spi protein spans the amino acid sequence from region 24-241aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Spi, Spiralin

UniProt

P19215

Expression Region

24-241aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Spiroplasma citri

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CNKTESNNLSIVKTIAVPATVATANPKQVTNAEIKTALEANVLKAVQGVVKTATAADFQFDVYQDNKGTSLTTINLEEGNVEVYVQITPAKDKTVVIGETGYIKVTLPKIKVDISGVVIDQQIVEIKAADPKQVTKDELNAVNTYATLASAVLEAIKNKAPNAGASDFEITNNCDAGDYSAQKDVKVTVKAKDESPNISGEFKVNAKVKATLAPPKAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOLR1 siRNA (Human)
MBS828938-01 15 nmol

FOLR1 siRNA (Human)

Sign In for Pricing
View Details
FOLR1 siRNA (Human)
MBS828938-02 30 nmol

FOLR1 siRNA (Human)

Sign In for Pricing
View Details
FOLR1 siRNA (Human)
MBS828938-03 5x 30 nmol

FOLR1 siRNA (Human)

Sign In for Pricing
View Details
ELISA Kit for CCAAT/Enhancer Binding Protein Beta (CEBPb)
TRV-0040722-01 24 Tests

ELISA Kit for CCAAT/Enhancer Binding Protein Beta (CEBPb)

Sign In for Pricing
View Details
ELISA Kit for CCAAT/Enhancer Binding Protein Beta (CEBPb)
TRV-0040722-02 48 Tests

ELISA Kit for CCAAT/Enhancer Binding Protein Beta (CEBPb)

Sign In for Pricing
View Details
ELISA Kit for CCAAT/Enhancer Binding Protein Beta (CEBPb)
TRV-0040722-03 96 Tests

ELISA Kit for CCAAT/Enhancer Binding Protein Beta (CEBPb)

Sign In for Pricing
View Details