Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Esm1 protein

This Mouse Esm1 protein spans the amino acid sequence from region 22-184aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, ESM-1

UniProt

Q9QYY7

Expression Region

22-184aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PCSK9 Protein, His Tag
E40KMPH6308 20 µg

Human PCSK9 Protein, His Tag

Sign In for Pricing
View Details
Human Transcription factor SOX-9 (SOX9) ELISA Kit
AE17644HU-01 48 Tests

Human Transcription factor SOX-9 (SOX9) ELISA Kit

Sign In for Pricing
View Details
Human Transcription factor SOX-9 (SOX9) ELISA Kit
AE17644HU-02 96 Tests

Human Transcription factor SOX-9 (SOX9) ELISA Kit

Sign In for Pricing
View Details
B85-178X15-569-OC Continuous Tapes for Printers
099169 1 Box (1 Roll x 1 Roll)

B85-178X15-569-OC Continuous Tapes for Printers

Sign In for Pricing
View Details
2-Aminofluorene
sc-225162 5 g

2-Aminofluorene

Sign In for Pricing
View Details
Actin (ACTA1) (NM_001100) Human Tagged Lenti ORF Clone
RC203112L4 10 µg

Actin (ACTA1) (NM_001100) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details