Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Esm1 protein

This Mouse Esm1 protein spans the amino acid sequence from region 22-184aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, ESM-1

UniProt

Q9QYY7

Expression Region

22-184aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

dnaK / Hsp70 (1-384) Escherichia coli Protein
SA6025X 500 µg

dnaK / Hsp70 (1-384) Escherichia coli Protein

Sign In for Pricing
View Details
Zebrafish USP7 Rabbit Polyclonal Antibody (Fluoro594)
orb3090788 100 µg

Zebrafish USP7 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Hamster Anti-Mouse CD30-FITC
MBS673314-01 0.5 mg

Hamster Anti-Mouse CD30-FITC

Sign In for Pricing
View Details
Hamster Anti-Mouse CD30-FITC
MBS673314-02 5x 0.5 mg

Hamster Anti-Mouse CD30-FITC

Sign In for Pricing
View Details
FUT3 Rabbit pAb
E2515058 100 µL

FUT3 Rabbit pAb

Sign In for Pricing
View Details
Biotin Conjugation Kit (30-100 kDa)
abx294440-01 1 Reaction

Biotin Conjugation Kit (30-100 kDa)

Sign In for Pricing
View Details