Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Esm1 protein

This Mouse Esm1 protein spans the amino acid sequence from region 22-184aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Short name, ESM-1

UniProt

Q9QYY7

Expression Region

22-184aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKYAVDCPEHCDKTECRSSLRCKRTVLDDCGCCQVCAAGPGETCYRTVSGMDGVKCGPGLKCHFYSEEDDFGDEFGICKDCPYGTFGMECKETCNCQSGICDRVTGRCLDFPFFQYAAAKSPSRTSASHTERDSASGDGNAVREEIGEGNAARPSVMKWLNPR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

QDPR Rabbit pAb
E45R26054N 50 ul

QDPR Rabbit pAb

Sign In for Pricing
View Details
Asb11 Peptide - N-terminal region (AAP51818)
AAP51818-100UG 100 µg

Asb11 Peptide - N-terminal region (AAP51818)

Sign In for Pricing
View Details
Lentiviral human H4C11 shRNA (UAS) - Lentiviral human H4C11 shRNA (UAS, GFP) (100)
GTR15347508 1 Vial

Lentiviral human H4C11 shRNA (UAS) - Lentiviral human H4C11 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Bovine NPT (Neopterin) ELISA Kit
EB0167 96 Tests

Bovine NPT (Neopterin) ELISA Kit

Sign In for Pricing
View Details
CDK2 (Cyclin-dependent Kinase 2)
477657 100 µL

CDK2 (Cyclin-dependent Kinase 2)

Sign In for Pricing
View Details
MAb to Human Alpha Fetoprotein
MBS311557-01 1 mg

MAb to Human Alpha Fetoprotein

Sign In for Pricing
View Details