Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD1C protein

This Human CD1C protein spans the amino acid sequence from region 18-302aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD_antigen, CD1c

UniProt

P29017

Expression Region

18-302aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NADASQEHVSFHVIQIFSFVNQSWARGQGSGWLDELQTHGWDSESGTIIFLHNWSKGNFSNEELSDLELLFRFYLFGLTREIQDHASQDYSKYPFEVQVKAGCELHSGKSPEGFFQVAFNGLDLLSFQNTTWVPSPGCGSLAQSVCHLLNHQYEGVTETVYNLIRSTCPRFLLGLLDAGKMYVHRQVRPEAWLSSRPSLGSGQLLLVCHASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPAGLSCRVRHSSLGGQDIILYWGHHFSM

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXW12 (NM_001159929) Human Tagged ORF Clone
RG228901 10 µg

FBXW12 (NM_001159929) Human Tagged ORF Clone

Sign In for Pricing
View Details
LOC100043224 shRNA Plasmid (m)
sc-148308-SH 20 µg

LOC100043224 shRNA Plasmid (m)

Sign In for Pricing
View Details
Human MTTP Protein Lysate
MBS8415627-01 0.02 mg

Human MTTP Protein Lysate

Sign In for Pricing
View Details
Human MTTP Protein Lysate
MBS8415627-02 5x 0.02 mg

Human MTTP Protein Lysate

Sign In for Pricing
View Details
Neo Enrichment Selective Supplement
MS 2249 5 Vials

Neo Enrichment Selective Supplement

Sign In for Pricing
View Details
ACTGP4 CRISPR Knock Out 293T Cell Line (Human)
52339141 1x 10^6 Cells / 1.0 mL

ACTGP4 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details