Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat C1qa protein

This Rat C1qa protein spans the amino acid sequence from region 23-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1qa, Complement C1q subcomponent subunit A

UniProt

P31720

Expression Region

23-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDVCRAPNGKDGVAGIPGRPGRPGLKGERGEPGAAGIRTGIRGLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPPTYGNVVVFDKVLTNQENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSSSRGQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human NOTCH3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 200UL
IRBAMLNOTCH3AP95200UL 200 µL

Rabbit Anti Human NOTCH3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 200UL

Sign In for Pricing
View Details
DNAH8 Peptide
DF15141-BP 1 mg

DNAH8 Peptide

Sign In for Pricing
View Details
RBP1 Protein Vector (Human) (pPM-C-HA)
PV057063 500 ng

RBP1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
EL4 (EL-4) Cell Line (Mouse lymphoma)
116006 1 Vial

EL4 (EL-4) Cell Line (Mouse lymphoma)

Sign In for Pricing
View Details
(2-Cyanoethyl) ethyl-carbamic Acid tert-Butyl Ester
159526 250 mg

(2-Cyanoethyl) ethyl-carbamic Acid tert-Butyl Ester

Sign In for Pricing
View Details
ICAM1 (BB2, CD54, Cell Surface Glycoprotein P3.58, Human Rhinovirus Receptor, ICAM1, ICAM-1, intercellular Adhesion Molecule 1, Intercellular Adhesion Molecule 1 (CD54), Human Rhinovirus Receptor, Major Group Rhinovirus Receptor, P3.58)
319861-01 50 µL

ICAM1 (BB2, CD54, Cell Surface Glycoprotein P3.58, Human Rhinovirus Receptor, ICAM1, ICAM-1, intercellular Adhesion Molecule 1, Intercellular Adhesion Molecule 1 (CD54), Human Rhinovirus Receptor, Major Group Rhinovirus Receptor, P3.58)

Sign In for Pricing
View Details