Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat C1qa protein

This Rat C1qa protein spans the amino acid sequence from region 23-245aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C1qa, Complement C1q subcomponent subunit A

UniProt

P31720

Expression Region

23-245aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EDVCRAPNGKDGVAGIPGRPGRPGLKGERGEPGAAGIRTGIRGLKGDMGESGPPGKPGNVGFPGPTGPLGNSGPQGLKGVKGNPGNIRDQPRPAFSAIRQNPPTYGNVVVFDKVLTNQENPYQNRTGHFICAVPGFYYFTFQVISKWDLCLSIVSSSRGQPRNSLGFCDTNSKGLFQVLAGGTVLQLQRGDEVWIEKDPAKGRIYQGTEADSIFSGFLIFPSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LPL Antibody / Lipoprotein lipase
RQ5165 100 µL

LPL Antibody / Lipoprotein lipase

Sign In for Pricing
View Details
DB1255 2TFA
T68359L-01 1 mg

DB1255 2TFA

Sign In for Pricing
View Details
DB1255 2TFA
T68359L-02 5 mg

DB1255 2TFA

Sign In for Pricing
View Details
DB1255 2TFA
T68359L-03 10 mg

DB1255 2TFA

Sign In for Pricing
View Details
DEFB20 siRNA (Mouse)
CRN4312-01 15 nmol

DEFB20 siRNA (Mouse)

Sign In for Pricing
View Details
DEFB20 siRNA (Mouse)
CRN4312-02 30 nmol

DEFB20 siRNA (Mouse)

Sign In for Pricing
View Details