Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Monkey Transthyretin protein

This Monkey Transthyretin protein spans the amino acid sequence from region 21-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Amyloidosis I protein, ATTR protein, CTS protein, CTS1 protein, HEL111 protein, HsT2651 protein, PALB protein, Prealbumin amyloidosis type I protein, TBPA protein, Transthyretin protein, TTR protein, TTR protein protein

UniProt

Q5NVS2

Expression Region

21-147aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPTGAGESKCPLMVKVLDAVRGSPAVNVAVNVFKRAADETWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFAANDSGPRRYTIAALLSPYSYSTTAVVTNPKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Methionine Aminopeptidase 2 Antibody
KC-7697-01 50 μL

Methionine Aminopeptidase 2 Antibody

Sign In for Pricing
View Details
Methionine Aminopeptidase 2 Antibody
KC-7697-02 100 µL

Methionine Aminopeptidase 2 Antibody

Sign In for Pricing
View Details
Methionine Aminopeptidase 2 Antibody
KC-7697-03 1 mL

Methionine Aminopeptidase 2 Antibody

Sign In for Pricing
View Details
Paraffin Dispenser BHTP-604
BHTP-604 1 Unit

Paraffin Dispenser BHTP-604

Sign In for Pricing
View Details
Hydromount
HS-106 100 mL

Hydromount

Sign In for Pricing
View Details
PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF640R conjugate, 0.1mg/mL
BNC403065-100 1x 100 µL

PCNA (Proliferating Cell Nuclear Antigen) (G1- & S-phase Marker) (PC5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details