Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal JTB protein

This Animal JTB protein spans the amino acid sequence from region 31-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

JTB, Protein JTB

UniProt

O77049

Expression Region

31-105aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Brugia malayi (Filarial nematode worm)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vitamin K1 2,3-Epoxide
TRC-V676100-50MG 50 mg

Vitamin K1 2,3-Epoxide

Sign In for Pricing
View Details
GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H10]
TA505480AM 100 µL

GADD45G Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H10]

Sign In for Pricing
View Details
Vmn1r195 Mouse Gene Knockout Kit (CRISPR)
KN518986 1 Kit

Vmn1r195 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mangostin
TRC-M164500-5MG 5 mg

Mangostin

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR560458 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD163 Antibody[S15049F]
E-AB-F1295UM-01 25 µg

Elab Fluor® 647 Anti-Mouse CD163 Antibody[S15049F]

Sign In for Pricing
View Details