Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal JTB protein

This Animal JTB protein spans the amino acid sequence from region 31-105aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

JTB, Protein JTB

UniProt

O77049

Expression Region

31-105aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Brugia malayi (Filarial nematode worm)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAPVREEKLSVSTSTSPCWLVEEFVVTEECAPCSNFQIKSTPECGSTGYMEKITCSPSKRNEFRSCRSALMERHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Protein Lysate, Ovary
CP565731 150 µg

Tissue Protein Lysate, Ovary

Sign In for Pricing
View Details
PRKAR2B Polyclonal Antibody
E-AB-90471-01 60 µL

PRKAR2B Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR2B Polyclonal Antibody
E-AB-90471-02 120 µL

PRKAR2B Polyclonal Antibody

Sign In for Pricing
View Details
PRKAR2B Polyclonal Antibody
E-AB-90471-03 200 µL

PRKAR2B Polyclonal Antibody

Sign In for Pricing
View Details
Water content Tester BPTL-241
BPTL-241 1 Unit

Water content Tester BPTL-241

Sign In for Pricing
View Details
MSH2 Antibody
KC-550-01 50 μL

MSH2 Antibody

Sign In for Pricing
View Details