Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GUK1 protein

This Human GUK1 protein spans the amino acid sequence from region 2-197aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GMP kinase

UniProt

Q16774

Expression Region

2-197aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Neurofilament light polypeptide (NEFL), partial
RPC31240-01 20 µg

Recombinant Human Neurofilament light polypeptide (NEFL), partial

Sign In for Pricing
View Details
Recombinant Human Neurofilament light polypeptide (NEFL), partial
RPC31240-02 100 µg

Recombinant Human Neurofilament light polypeptide (NEFL), partial

Sign In for Pricing
View Details
Recombinant Human Neurofilament light polypeptide (NEFL), partial
RPC31240-03 1 mg

Recombinant Human Neurofilament light polypeptide (NEFL), partial

Sign In for Pricing
View Details
Lysis Buffer
H1002-50 50 mL

Lysis Buffer

Sign In for Pricing
View Details
Satb1 (NM_001163631) Mouse Tagged Lenti ORF Clone
MR223656L4 10 µg

Satb1 (NM_001163631) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
6-Nitrobenzo[d][1,3]dioxole-5-carboxylic acid
OR80564-01 10 g

6-Nitrobenzo[d][1,3]dioxole-5-carboxylic acid

Sign In for Pricing
View Details