Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacterial ynaB protein

This Bacterial ynaB protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

YnaB, BSU17500, Uncharacterized protein YnaB

UniProt

P94480

Expression Region

1-144aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bacillus subtilis (strain 168)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYNEVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDMLVSLNGTKYWEVNPNLQEYYKLVSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), Biotin conjugate, 0.1mg/mL
BNCB2125-500 1x 500 µL

Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin V-EGFP/DAPI Apoptosis Kit
E-CK-A260-01 20 Assays

Annexin V-EGFP/DAPI Apoptosis Kit

Sign In for Pricing
View Details
Annexin V-EGFP/DAPI Apoptosis Kit
E-CK-A260-02 100 Assays

Annexin V-EGFP/DAPI Apoptosis Kit

Sign In for Pricing
View Details
Fmoc-Trp (Boc) TentaGel® R TRT Resin
RA1228.1G 1 g

Fmoc-Trp (Boc) TentaGel® R TRT Resin

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF405S conjugate, 0.1mg/mL
BNC042362-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NF1 Polyclonal Antibody
E-AB-53528-01 20 µL

NF1 Polyclonal Antibody

Sign In for Pricing
View Details