Bacterial ynaB protein
This Bacterial ynaB protein spans the amino acid sequence from region 1-144aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
YnaB, BSU17500, Uncharacterized protein YnaB
UniProt
P94480
Expression Region
1-144aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Bacillus subtilis (strain 168)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
32.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
This is His-SUMO-tag protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEDATFHFKDPASPQEISDIEQKLGVTFPNDYKEFLLQHNGMEMFDGIEILSLEGIIEYNEVQDFPEGYVLIGYHFDGRYVIDTNKSKNGLGYMLYLDSIDDIEDAINLDSNFEIWFDMLVSLNGTKYWEVNPNLQEYYKLVSE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400918-100 1x 100 µL
CD44 Standard (HCAM/918), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC403217-100 1x 100 µL
Cytokeratin 18 (KRT18) (rKRT18/1190), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742362-500 1x 500 µL
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/2362), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC743635-500 1x 500 µL
Tenascin C (Stromal Marker for Epithelial Malignancy) (TNC/3635), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681563-500 1x 500 µL
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1563), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details