What is the catalog number for Bacterial mecA protein?

The catalog number for Bacterial mecA protein is orb358825.

What sizes are available for Bacterial mecA protein?

Bacterial mecA protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Bacterial mecA protein come in?

Bacterial mecA protein is available in 3 different pack sizes.

Is Bacterial mecA protein in stock?

Bacterial mecA protein is currently made to order / not held in immediate stock. Contact us for lead time.

Bacterial mecA protein

This Bacterial mecA protein spans the amino acid sequence from region 1-239aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MecA, MW0880Adapter protein MecA

UniProt

P60186

Expression Region

1-239aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRIERVDDTTVKLFITYSDIEARGFSREDLWTNRKRGEEFFWSMMDEINEEEDFVVEGPLWIQVHAFEKGVEVTISKSKNEDMMNMSDDDATDQFDEQVQELLAQTLEGEDQLEELFEQRTKEKEAQGSKRQKSSARKNTRTIIVKFNDLEDVINYAYHSNPITTEFEDLLYMVDGTYYYAVHFDSHVDQEVINDSYSQLLEFAYPTDRTEVYLNDYAKIIMSHNVTAQVRRYFPETTE