Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli glcC protein

This E. coli glcC protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GlcC, c3710, Glc operon transcriptional activator, Glc regulatory protein, HTH-type transcriptional regulator GlcC

UniProt

P0ACL6

Expression Region

1-254aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGHHLIRSAVPLEMNLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-532-3p miRNA Antagomir
MNH02950 2x 5.0 nmol

hsa-miR-532-3p miRNA Antagomir

Sign In for Pricing
View Details
RGD1559143 3'UTR Luciferase Stable Cell Line
TU218019 1.0 mL

RGD1559143 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Pygo2 shRNA (UAS) - Lentiviral mouse Pygo2 shRNA (UAS, GFP) (100)
GTR15256557 1 Vial

Lentiviral mouse Pygo2 shRNA (UAS) - Lentiviral mouse Pygo2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Phospho-A-RAF (Tyr302) BioAssayTM ELISA Kit
472783 2x 96 Tests

Phospho-A-RAF (Tyr302) BioAssayTM ELISA Kit

Sign In for Pricing
View Details
CD97 Rabbit Polyclonal Antibody
orb13718-01 50 μL

CD97 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD97 Rabbit Polyclonal Antibody
orb13718-02 100 µL

CD97 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details