Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli glcC protein

This E. coli glcC protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GlcC, c3710, Glc operon transcriptional activator, Glc regulatory protein, HTH-type transcriptional regulator GlcC

UniProt

P0ACL6

Expression Region

1-254aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKDERRPICEVVAESIERLIIDGVLKVGQPLPSERRLCEKLGFSRSALREGLTVLRGRGIIETAQGRDSRVARLNRVQDTSPLIHLFSTQPRTLYDLLDVRALLEGESARLAATLGTQADFVVITRCYEKMLAASENNKEISLIEHAQLDHAFHLAICQASHNQVLVFTLQSLTDLMFNSVFASVNNLYHRPQQKKQIDRQHARIYNAVLQRLPHVAQRAARDHVRTVKKNLHDIELEGHHLIRSAVPLEMNLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMDHD1 Protein Vector (Rat) (pPM-C-HA)
PV253396 500 ng

AMDHD1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
C20orf94 Rabbit Polyclonal Antibody (BF680)
orb2509494 100 µL

C20orf94 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
ARD1A Antibody
DF12828-01 100 µL

ARD1A Antibody

Sign In for Pricing
View Details
ARD1A Antibody
DF12828-02 200 µL

ARD1A Antibody

Sign In for Pricing
View Details
Recombinant Human TRGV9/Vγ 9 (TCR) Protein, N-His
HP264012-01 50 µg

Recombinant Human TRGV9/Vγ 9 (TCR) Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TRGV9/Vγ 9 (TCR) Protein, N-His
HP264012-02 100 µg

Recombinant Human TRGV9/Vγ 9 (TCR) Protein, N-His

Sign In for Pricing
View Details